SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008854 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008854
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily C-type lectin-like 1.66e-32
Family C-type lectin domain 0.000000631
Further Details:      
 
Domain Number 2 Region: 108-131
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000000000641
Family Triple coiled coil domain of C-type lectins 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008854   Gene: ENSGGOG00000009057   Transcript: ENSGGOT00000009094
Sequence length 248
Comment pep:known chromosome:gorGor3.1:10:65042992:65046700:-1 gene:ENSGGOG00000009057 transcript:ENSGGOT00000009094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG
EPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA
RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIRNLIKE
EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
LAVCEFPI
Download sequence
Identical sequences Q66S60
ENSGGOP00000008854 XP_004049476.1.27298 XP_018889897.1.27298 ENSGGOP00000008854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]