SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008856 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008856
Domain Number 1 Region: 456-683
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.75e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000467
Further Details:      
 
Domain Number 2 Region: 29-189
Classification Level Classification E-value
Superfamily Fibronectin type III 3.16e-26
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 3 Region: 200-322
Classification Level Classification E-value
Superfamily Fibronectin type III 1.18e-17
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 4 Region: 323-414
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000289
Family Fibronectin type III 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000008856
Domain Number - Region: 412-453
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0654
Family Glycerol-3-phosphate transporter 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008856   Gene: ENSGGOG00000009047   Transcript: ENSGGOT00000009097
Sequence length 717
Comment pep:known_by_projection chromosome:gorGor3.1:19:52683787:52719860:-1 gene:ENSGGOG00000009047 transcript:ENSGGOT00000009097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGGGLGVWGNLVLLGLCSWTGARAPAPNPGRNLTVETQTTSSISLSWKAPAGTDSQN
STYSVQCTGDGGRSETRTTRYTVIVYGLGPGSLYTCSVWVEKDGVNSSVEIVTSATAPNP
VRNLTVEAQTNSSIALTWEVPSGPDPQNSTYGVEYTGDGGRAGTRSTAYTNITMDGLEPG
CLYAFSVWVGKNGINSSRETRNATTAVDGLEPGCLYAFSVWVGKNGINSSRETRNATTAP
NPVRNLHVKTQTNSSIALCWEVPDGPYPQDYTYWVEYTGDGGGTETRNTTNISVTAEGLE
PGTLYTFSVWAEKNGVRGSRQNVSISTVPNAVTSLSKQDWTNSTIALRWTAPQGPGQSSY
SYWVSWVREGMTDPRTQSTSGTDITLKELEAGSLYHLTVWAERNEVRGYNSTLTAATGVI
AGAFVGILLFLILVGLLIFFLKRRNKKQQKPELRDLVFDWSRVPLKPIHEEPGSDYINAS
FMPGLWSPQEFIATQGPLPQTVGDFWRLVWEQQSHTLVMLTNCMEAGRVKCEHYWPLDSQ
PCTHGHLRVTLVGEEVMENWTVRELQLLQVEEQKTLSVRQFHYQAWPDHGVPSSPDILLA
FWRMLRQWLDQTMEGGPPIVHCSAGVGRTGTLIALDVLLRQLQSEGLLGPFSFVRKMRES
RPLMVQTEAQYVFLHQCILRFLQQSAQAPAKKEAPYEDVENLIYENVAAIQAHKLEV
Download sequence
Identical sequences ENSGGOP00000008856 ENSGGOP00000008856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]