SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008864 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008864
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily EF-hand 0.00000000376
Family Parvalbumin 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008864   Gene: ENSGGOG00000009068   Transcript: ENSGGOT00000009105
Sequence length 71
Comment pep:novel chromosome:gorGor3.1:7:5860144:5865348:1 gene:ENSGGOG00000009068 transcript:ENSGGOT00000009105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSITDVLSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLD
EEELFQEMVHS
Download sequence
Identical sequences G3R115
ENSGGOP00000008864 ENSGGOP00000008864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]