SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008887 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008887
Domain Number 1 Region: 68-281
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.89e-53
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 288-329
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000157
Family SOCS box-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008887   Gene: ENSGGOG00000009089   Transcript: ENSGGOT00000009131
Sequence length 330
Comment pep:known_by_projection chromosome:gorGor3.1:4:186855029:186910810:-1 gene:ENSGGOG00000009089 transcript:ENSGGOT00000009131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLEENRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYG
VTQGQAGSWADRSPLHEAASQGRLLALRTLLSQGYNVNAVTLDHVTPLHEACLGDHVACA
RTLLEAGANVNAITIDGVTPLFNACSQGSPSCAELLLEYGAKAQLESCLPSPTHEAASKG
HHECLDILISWGIDVDQEIPHLGTPLYVACMSQQFHCIWKLLYAGADVQKGKYWDTPLHA
AAQQSSTEIVNLLLEFGADINAKNTELLRPVDVAMSSSMVERILLQHEATPSSLYQLCRL
CIRSYIGKPRLHLIPQLQLPTLLKNFLQYR
Download sequence
Identical sequences ENSGGOP00000008887 ENSGGOP00000008887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]