SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008889 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008889
Domain Number 1 Region: 224-319
Classification Level Classification E-value
Superfamily EF-hand 5.39e-29
Family Eps15 homology domain (EH domain) 0.00000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008889   Gene: ENSGGOG00000009083   Transcript: ENSGGOT00000009133
Sequence length 745
Comment pep:known_by_projection chromosome:gorGor3.1:6:139716472:139797600:-1 gene:ENSGGOG00000009083 transcript:ENSGGOT00000009133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELCGATRLGYFGRSQFYIALKLVAVAQSGFPLRVESINTVKDLPLPRFVASKNEQESRH
AASYSSDSENQGSYSGVIPPPPGRGQVKKGSVSHDTVQPRTSADAQEPASPVVSPQQSPP
TSPHTWRKHSRHPSGGNSERPLAGPGPFWSPFGEAQSGSSAGDAVWSGHSPPPPQENWVS
FADTPPTSTLLTMHPASVQDQTTVRTVASATTAIEIRRQSSSYDDPWKITDEQRQYYVNQ
FKTIQPDLNGFIPGSAAKEFFTKSKLPILELSHIWELSDFDKDGALTLDEFCAAFHLVVA
RKNGYDLPEKLPESLMPKLIDLEDSADVGDQPGEVGYSGSPAEAPPSKSPSMPSLNQTWP
ELNQSSEQWETFSERSSSSQTLTQFDSNIAPADPDTAIVHPVPIRMTPSKIHMQEMELKR
TGSDHTNPTSPLLVKPSDLSEENKINSSVKFASGNTVADGYSSSDSFTSDPEQIGSNVTR
QRSHSGTSPDNTAPPPPPPRPQPSHSRSSSLDMNRTFTVTTVPQNNLTASLWMCLPHEPY
RSKKAPGPAVHRPVDADGLITHTSTSPQQIPEQPNFADFSQFEVFAASNVNDEQDDEAEK
HPEVLPAEKASDPASSLRVAKTDSKTEEKTAASAPANVSKGTTPLAPPPKPIRRRLKSED
ELRPEVDEHTQKTGVLAAVLASQPSIPRSVGKDKKAIQASIRRNKETNTVLARLNSELQQ
QLKDVLEERISLEVQLEQLRPFSHL
Download sequence
Identical sequences ENSGGOP00000008889 ENSGGOP00000008889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]