SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008897 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008897
Domain Number 1 Region: 281-373
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-19
Family SPRY domain 0.0017
Further Details:      
 
Domain Number 2 Region: 7-81
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-18
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 3 Region: 75-137
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000102
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008897   Gene: ENSGGOG00000009103   Transcript: ENSGGOT00000009142
Sequence length 377
Comment pep:known_by_projection chromosome:gorGor3.1:16:31984222:31994041:1 gene:ENSGGOG00000009103 transcript:ENSGGOT00000009142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCRACLGRVAGEPAADGTVLCPCCQAPT
RPQALSTNLQLARLVEGLAQVPQGHCEEHLDPLSIYCEQDRALVCGVCASLGSHRGHRLL
PAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQLGKMR
VFLAALEGSLDREAERVRGEAGVALRRELGSLNSYLEQLRQMEKVLEEVADKPQTEFLMK
YCLVTSRLQKILAESPPPARLDIQLPIISDDFKFQVWRKMFRALMPALEELTFDPSSAHP
SLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRWALG
VLHAVPSQGLWLLGLRE
Download sequence
Identical sequences ENSGGOP00000008897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]