SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008927 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008927
Domain Number 1 Region: 457-653,754-1010
Classification Level Classification E-value
Superfamily Ras GEF 2.48e-116
Family Ras GEF 0.00015
Further Details:      
 
Domain Number 2 Region: 200-338
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-43
Family DEP domain 0.000000169
Further Details:      
 
Domain Number 3 Region: 661-763
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.79e-36
Family Ras-binding domain, RBD 0.0012
Further Details:      
 
Domain Number 4 Region: 21-157
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.59e-26
Family cAMP-binding domain 0.000000194
Further Details:      
 
Domain Number 5 Region: 331-460
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-25
Family cAMP-binding domain 0.000000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008927   Gene: ENSGGOG00000009121   Transcript: ENSGGOT00000009173
Sequence length 1011
Comment pep:known_by_projection chromosome:gorGor3.1:2b:60618923:60937904:1 gene:ENSGGOG00000009121 transcript:ENSGGOT00000009173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGY
YENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILDN
TPRHATIVTRESSELLRIEQKDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKENT
PLIEPHVPLRPANTITKVPSEKILRAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGTE
LVDWMMQQTPCVHSRTQAVGMWQVLLEDGVLNHVDQEHHFQDKYLFYRFLDDEHEDAPLP
TEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYEELLHIKALSHL
STTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDD
FGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKV
PAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVF
MPNTQLCPALVAHYHAQPSQGTEQEKMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVSMA
FLEEFYVSVSDDARMIAALKEQLPELEKIVKQISEDAKAPQKKHKVLLQQFSTGDERAQK
RQPIRGSDEVLFKVYCMDHTYTTIRVPVATSVKEVISAVADKLGSGEGLIIVKMSSGGEK
VVLKPNDVSVFTTLTINGRLFACPREQFDSLTPLPEQEGPTVGTVATFELMSSKDLAYQM
TIYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEICLCSQLSKR
VQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLM
DPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTART
VRYYRSQPFNPDAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP
Download sequence
Identical sequences ENSGGOP00000008927 ENSGGOP00000008927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]