SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009000 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009000
Domain Number 1 Region: 290-320
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000053
Family CCCH zinc finger 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009000
Domain Number - Region: 213-244
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00667
Family CCCH zinc finger 0.0061
Further Details:      
 
Domain Number - Region: 266-315,757-804
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0251
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number - Region: 90-112
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0353
Family CCCH zinc finger 0.0057
Further Details:      
 
Domain Number - Region: 646-688
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.0369
Family Outer membrane lipoprotein 0.0087
Further Details:      
 
Domain Number - Region: 121-157
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0589
Family CCCH zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009000   Gene: ENSGGOG00000009203   Transcript: ENSGGOT00000009250
Sequence length 810
Comment pep:known_by_projection chromosome:gorGor3.1:5:7423100:7464627:-1 gene:ENSGGOG00000009203 transcript:ENSGGOT00000009250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKGPGPGGSAASSAPPAATAQVLQAQPEKPQHYTYLKEFRTEQCPLFVQHKCTQHRPYT
CFHWHFVNQRRRRSIRRRDGTFNYSPDVYCTKYDEATGLCPEGDECPFLHRTTGDTERRY
HLRYYKTGICIHETDSKGNCTKNGLHCAFAHGPHDLRSPVYDIRELQAMEALQNGQTTVE
GSIEGQSAGAASHAMIEKILSEEPRWQETAYVLGNYKTEPCKKPPRLCRQGYACPYYHNS
KDRRRSPRKHKYRSSPCPNVKHGDEWGDPGKCENGDACQYCHTRTEQQFHPEIYKSTKCN
DMQQSGSCPRGPFCAFAHVEQPPLSDDLQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSS
PHAPDLSALLCRNSSLGSPSNLCGSPPGSIRKPPNLEGIVFPGESGLAPGSYKKAPGFER
EDQVGAEYLKNFKCQAKLKPHSLEPRSQEQPLLQPKQDMLGILPAGSPLTSSISSSITSS
LAATPPSPVGTSSVPGMNANALPFYPTSDTVESVIESALDDLDLNEFGVAALEKTFDNST
VPHPGSITIGGSLLQSSAPVNIPGSLGSSASFHSASPSPPVSLSSHFLQQPQGHLSQSEN
TFLGTSASHGSLGLNGMNSSIWEHFASGSFSPGTSPAFLSGPGAAELARLRQELDEANST
IKQWEESWKQAKQACDAWKKEAEEAGERASAAGAECELAREQRDALEVQVKKLQEELERL
HAGPEPQALPAFSDLEALSLSTLYSLQKQLRAHLEQVDKAVFHMQSVKCLKCQEQKRAVL
PCQHAALCELCAEGSECPICQPGRAHTLQS
Download sequence
Identical sequences A0A024R8N4 G3R1E1 K7BR55 Q9C0B0
NP_001073888.2.87134 NP_001073888.2.92137 XP_008964078.1.60992 XP_016786386.1.37143 XP_018882272.1.27298 ENSGGOP00000009000 ENSGGOP00000009000 ENSP00000464893 ENSP00000464893 gi|331028525|ref|NP_001073888.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]