SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009041 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009041
Domain Number 1 Region: 97-108,199-433
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8e-50
Family Nuclear receptor ligand-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 24-106
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009041   Gene: ENSGGOG00000009250   Transcript: ENSGGOT00000009291
Sequence length 447
Comment pep:known_by_projection chromosome:gorGor3.1:9:107903441:108138374:-1 gene:ENSGGOG00000009250 transcript:ENSGGOT00000009291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFCQDELAELDPGTISVSDDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRV
YRCSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISEEEI
ERIMSGQEFEEEANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSSRSVELNGFMAFREQ
YMGMSVPPHYQYIPHLFSYSGHSPLLPPQARSLDPQSYSLIHQLLSAEDLEPLGTPMLIE
DGYAVTQAELFALLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSL
TVYSKQIFGELADVTAKYSPSDEELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYACMK
AINFLNQDIRGLTSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGK
MVNVPLEQLPLLFKVVLHSCKTSVGKE
Download sequence
Identical sequences ENSGGOP00000009041 ENSGGOP00000009041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]