SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009051 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009051
Domain Number 1 Region: 145-226
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.04e-21
Family Complement control module/SCR domain 0.00000333
Further Details:      
 
Domain Number 2 Region: 24-90
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.89e-17
Family Complement control module/SCR domain 0.0000227
Further Details:      
 
Domain Number 3 Region: 81-142
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000195
Family Complement control module/SCR domain 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009051   Gene: ENSGGOG00000009261   Transcript: ENSGGOT00000009302
Sequence length 226
Comment pep:known_by_projection chromosome:gorGor3.1:5:17407214:17422432:1 gene:ENSGGOG00000009261 transcript:ENSGGOT00000009302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISPVLILFSSFLCHVAIAGRTRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGA
DSAKCTEEGKWSPELPVCAPITCPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHA
MFGNDTITCTTHGNWTKLPECRASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFF
CKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Download sequence
Identical sequences ENSGGOP00000009051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]