SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009071 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009071
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.96e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0055
Further Details:      
 
Domain Number 2 Region: 246-419
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000356
Family FAD/NAD-linked reductases, N-terminal and central domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009071   Gene: ENSGGOG00000009281   Transcript: ENSGGOT00000009324
Sequence length 466
Comment pep:known_by_projection chromosome:gorGor3.1:1:126058901:126096253:-1 gene:ENSGGOG00000009281 transcript:ENSGGOT00000009324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKRIAVIGGGVSGLSSIKCCVEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNAQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDF
ATSGQWEVVTESEGKKEMNVFDGVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKNP
EGFTGKRVIIIGIGNSGGDLAVEISQTAKQALSQHPTVNDDLPNRIISGLVKVKGNVKEF
TETAAIFEDGSREDDIDAVIFATGYSFDFPFLEDSIKVVKNKISLYKKVFPPNLERPTLA
IIGLIQPLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAEISKAQEEIDKRYVESQRHT
IQGDYVDTMEELADLVGVRPNLLSLAFTDPKLALHLLLGPCTPIHYRVHGPGKWDGARKA
ILTTDDRIRKPLMTRVVERSSSMTSTMTIGKFMLALAFFAIIIAYF
Download sequence
Identical sequences ENSGGOP00000009071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]