SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009073 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009073
Domain Number 1 Region: 171-495
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.59e-55
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000103
Further Details:      
 
Domain Number 2 Region: 491-630
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.89e-28
Family Ricin B-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009073   Gene: ENSGGOG00000009285   Transcript: ENSGGOT00000009326
Sequence length 639
Comment pep:known_by_projection chromosome:gorGor3.1:3:16614265:16674070:1 gene:ENSGGOG00000009285 transcript:ENSGGOT00000009326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRKRYRHRPCRLQFLLLLLMLGCILMMVAMLHPPPHTLHQTVTAQASKHSPEARYRLD
FGESQDWVLEAEDEGEEYSPLEGLPPFISLREDQLLVAVALPQARRNQSQGRRGGSYRLI
KQPRRQDEEAPKRDWGADEDGEVSEEEELTLFSLDPRGLQEALSARIPLQRALPEVRHPL
CLQQHPQDSLPTASVILCFHDEAWSTLLRTVHSILDTVPRAFLKEIILVDDLSQQGQLKS
ALSEYVARLEGVKLLRSNKRLGAIRARMLGATRATGDVLVFMDAHCECHPGWLEPLLSRI
AGDRSRVVSPVIDVIDWKTFQYYPSKDLQRGVLDWKLDFHWEPLPEHVRKALQSPISPIR
SPVVPGEVVAMDRHYFQNTGAYDSLMSLQGGENLELSFKAWLCGGSVEILPCSRVGHIYQ
NQDSHSPLDQEATLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCVERLQLQRRL
GCRTFHWFLANVYPELYPSEPRPSFSGKLHNTGLGLCADCQAEGDILGCPMVLAPCSDSR
QQQYLQHTSRKEIHFGSPQHLCFAVRQEQVILQNCTEEGLAIHQQHWDFQENGMIVHILS
GKCMEAVVQENNKDLYLRPCDGKARQQWRFDQVNAVDER
Download sequence
Identical sequences G3R1J7
ENSGGOP00000009073 ENSGGOP00000009073 XP_004033744.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]