SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009094 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009094
Domain Number 1 Region: 216-279
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000229
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 541-612,648-737
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000791
Family SPRY domain 0.024
Further Details:      
 
Domain Number 3 Region: 425-529
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000782
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 4 Region: 25-74
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000278
Family RING finger domain, C3HC4 0.035
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009094
Domain Number - Region: 266-341
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0471
Family Apolipoprotein A-I 0.019
Further Details:      
 
Domain Number - Region: 158-200
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0547
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009094   Gene: ENSGGOG00000009309   Transcript: ENSGGOT00000009347
Sequence length 759
Comment pep:known_by_projection chromosome:gorGor3.1:1:134170725:134181357:1 gene:ENSGGOG00000009309 transcript:ENSGGOT00000009347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREV
LGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGA
LHPQVIMFPCPACQGDVELGERGLAGLFRNLTLERVVERYRQSVSVGGAILCQLCKPPPL
EATKGCTECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRPKGLMCPDHKEEVTHYCKT
CQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLTYILGNQDTVQTQICELEEAVR
HTEVSGQQAKEEVSQLVRGLGAVLEEKRASLLQAIEECQQERLARLSAQIQEHRSLLDGS
GLVGYAQEVLKETDQPCFVQAAKQLHNRIARATEALQTFRPAASSSFRHCQLDVGREMKL
LTELNFLRVPEAPVIDTQRTFAYDQIFLCWRLPPHSPPAWHYTVEFRRTDVPAQPGPTRW
QRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWG
TSRERLAISKDQRAVRSVPGLPLLLAADRLLTGCHLSVDVVLGDVAVTQGRSYWACAVDP
ASYLVKVGVGLESKLQESFQGAPDVISPRYDPDSGHDSGAEDATVEASPPFAFLTIGMGK
ILLGSGASSNAGLTGRDGPTAGCTVPLPPRLGICLDYERGRVSFLDAVSFRGLLECPLDC
SGPVCPAFCFIGGGAVQLQEPVGTKPERKVTIGGFAKLD
Download sequence
Identical sequences G3R1L6
ENSGGOP00000009094 XP_004026925.1.27298 ENSGGOP00000009094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]