SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009100 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009100
Domain Number 1 Region: 3-169
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.83e-27
Family FAD-linked reductases, N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009100   Gene: ENSGGOG00000009314   Transcript: ENSGGOT00000009353
Sequence length 216
Comment pep:known_by_projection chromosome:gorGor3.1:16:60325736:60330788:1 gene:ENSGGOG00000009314 transcript:ENSGGOT00000009353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAAGSTRFCAGILSTARHLTIEQKMADYSNKLYHQLEQETGIQTGYTRTGSIFLAQTQDR
LISLKRINAGLNVIGIPSEIISPKKVAGLHHLLNVHDLVGAMHVPEDAVVSSADVALALA
SAASQNGVQIYDRTSVLHVMVKKGQVTGVETDKGQIECQYFVNCAGQLLWMLMEEFIFGT
GRVASCLGALRRTRNQFSLRARTSWRFRIYRRLGSL
Download sequence
Identical sequences ENSGGOP00000009100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]