SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009101 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009101
Domain Number 1 Region: 80-196
Classification Level Classification E-value
Superfamily NTF2-like 0.000000000000057
Family TIM44-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009101   Gene: ENSGGOG00000025025   Transcript: ENSGGOT00000009354
Sequence length 233
Comment pep:known_by_projection chromosome:gorGor3.1:5:45901482:45927411:-1 gene:ENSGGOG00000025025 transcript:ENSGGOT00000009354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPIPQGFSCLSRVLGWWSRQPVLVTQSAAIVPVRTKKRFTPPIYQPKFKTEKEFMQHA
RKAGLVIPPEKSDRSIHLACTSDHDRLHTLVTEHCFPDMTWDIKYKTVRWSFVESLEPSH
VVQVRCSSMMNQGNVYGQITVRMHTRQTLAIYDRFGRLMYGQEDVPKDVLEYVVFEKQLT
NPYGSWRMHTKIVPPWAPPKQPILKTVMIPGPQLKPEEEYEEAQGEAQKPQLA
Download sequence
Identical sequences ENSGGOP00000009101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]