SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009127 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009127
Domain Number 1 Region: 29-202
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.81e-52
Family MHC antigen-recognition domain 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009127   Gene: ENSGGOG00000009347   Transcript: ENSGGOT00000009381
Sequence length 263
Comment pep:known_by_projection chromosome:gorGor3.1:6:150874486:150877018:-1 gene:ENSGGOG00000009347 transcript:ENSGGOT00000009381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRISLTSSPVRLLLLLLLLLIALEIMVGGHSLCFNFTIKLLSRPGQPWCEAQVFLNKNL
FLQYNSDNNMVKPLGLLGKKVNATSTWGELTQTLGEVGRDLRMLLLDIKPQIKTSGPSTL
QVEMFCQREAERCTGASWQFAINGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKY
FRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSVPDRWTILGAFILLVLMG
IVLICVWWQNGEWQAGLWPLRTS
Download sequence
Identical sequences G3R1P6
XP_018884917.1.27298 ENSGGOP00000009127 ENSGGOP00000009127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]