SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009128 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000009128
Domain Number - Region: 281-380
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0863
Family Formin homology 2 domain (FH2 domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009128   Gene: ENSGGOG00000015339   Transcript: ENSGGOT00000009382
Sequence length 548
Comment pep:novel chromosome:gorGor3.1:15:57616362:57628030:-1 gene:ENSGGOG00000015339 transcript:ENSGGOT00000009382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPQPYLPPDPMTPEETRRKKLAAAKKKLKEYQQRKSPGVPAGAKTKKKKTGSSPETTTS
GGCHSPGDPASSVTLKDLESQYQELAVALESSSVIINQLNENIESLKQQKKQVEHQLEEA
KKTNNEIHKAQMEQLEVQFQTINIRKGRLKITLYHTKRAARHFEEESEDLAGRLQYSLQR
IQELERALCAVSTQQQEEDRQSLSCREAVLQWRLQQTIKEQALLNAHVTQVTESLKQVQL
EQDEYAKRIKGERARWQERMWKMSVEATLKEEKKRDIHRIQELERSLSELKNQMAEPLSL
VPPAATSVVEQLQDEAKHLRQEVEGLEGKLQSQVENNQALSVLSKEQKQRLQEQEERLRE
QQERLRKQEERLQQLAEPQCSFEDLNNEKKSTLPLEQQVKELQEKLDEEHLEAASQQDQQ
LETQLSLMALPGEGTGGDEGEAAGGAKAGVAPCGNHEGHGKFLTTVQNPADEPAPGAPAP
QELGAAGEQDDFYEVSLDNNVEPAPGAAREGSPHDNPTAQQIVQDTEHPGLPSKPCVPFF
YRAPRTER
Download sequence
Identical sequences ENSGGOP00000009128 ENSGGOP00000024792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]