SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009132 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009132
Domain Number 1 Region: 137-257
Classification Level Classification E-value
Superfamily R3H domain 7.98e-42
Family R3H domain 0.00000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009132   Gene: ENSGGOG00000009337   Transcript: ENSGGOT00000009386
Sequence length 813
Comment pep:known_by_projection chromosome:gorGor3.1:3:36625815:36781845:1 gene:ENSGGOG00000009337 transcript:ENSGGOT00000009386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGA
GKGKLTRSLAVCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEKDKN
KDKTSEKPKIRMLSKDCSQEYTDSTGIDLHEFLINTLKNNSRDRMILLKMEQEIIDFIAD
NNNHYKKFPQMSSYQRMLVHRVAAYFGLDHNVDQTGKSVIINKTSSTRIPEQRFCEHLKD
EKGEESQKRFILKRDNSSIDKEDNQSVCSQESLLVENSRLLEDSNICNETYKKRQLFRGN
RDGSGRTSGSRQSSSENELKWSDHQRAWSSTDSDSSNRNLKPAMTKTASFGGITVLTRGD
STSSTRSTGKLSKAGSESSSSAGSSGSLSRTHPPLQSTPLVSGVAAGSPGCVPYPENGIG
GQVAPSSTSYILLPLEAATGIPPGSILLNPHTGQPFVNPDGTPAIYNPPTSQQPLRSAMV
GQSQQQPPQQQPSPQPQQQVQPPQPQMAGPLVTQSVQGLQASSQSVQYPAVSFPPQHLLP
VSPTQHFPMRDDVATQFGQMTLSRQSSGETPEPPSGPVYPSSLMPQPAQQPSYVIASTGQ
QLPTGGFSGSGPPISQQVLQPPPSPQGFVQQPPPAQMPVYYYPSGQYPTSTTQQYRPMAP
VQYNAQRSQQMPQAAQQAGYQPVLSGQQGFQGLIGVQQPPQSQNVMNNQQGTPVQSVMVS
YPTMSSYQVPMTQGSQVLPQQSYQQPIMLPNQAGQGSLPATGMPVYCNVTPPTPQNNLRL
IGPHCPSSTVPVMSASCRTNCASMSNAGWQVKF
Download sequence
Identical sequences ENSGGOP00000009132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]