SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009138 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009138
Domain Number 1 Region: 121-453
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.55e-73
Family beta-glycanases 0.0000000000159
Further Details:      
 
Domain Number 2 Region: 43-145
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.94e-34
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0000482
Further Details:      
 
Domain Number 3 Region: 452-519
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 6.23e-32
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009138   Gene: ENSGGOG00000009344   Transcript: ENSGGOT00000009392
Sequence length 519
Comment pep:known_by_projection chromosome:gorGor3.1:1:134207521:134214505:-1 gene:ENSGGOG00000009344 transcript:ENSGGOT00000009392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFSSPSREECPKPSGRVSIMAGSLTGLLLLQAVSWASGEWCPCIPKSFSYSSVACVCNA
TYCDSDPPTFPALGAFSRYKSRSSGHRMELSTGPYRTIQANCTGTGKHYTLHPPQKFQKV
KGFGRAVTDAGALNILALSPPAQNLLLKWYFSARGIGYNIIWVPMASCDFSICTYTYVDT
PDDFQLHNFSLPEEDTKLEIPLIHRALQLAQRPVSLLASPWSSPTRLKTRGVGNGKGSLK
GQPRDIYHQTWARYIVKFLDAYVEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPEHQRD
FIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYVDFLA
PAKATLRETHHLFPNTVLFASECVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWT
DWNPIVDITKHMFYKQPMFYHLGHFSKFIPEGSERVGLVASQKNDLDAVALMHPDGSAVV
VVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ
Download sequence
Identical sequences ENSGGOP00000009129 ENSGGOP00000009138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]