SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009158 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009158
Domain Number 1 Region: 702-1063
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.89e-89
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000549
Further Details:      
 
Domain Number 2 Region: 522-699
Classification Level Classification E-value
Superfamily ARM repeat 4.2e-63
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000253
Further Details:      
 
Domain Number 3 Region: 107-299
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.76e-46
Family Ras-binding domain, RBD 0.0012
Further Details:      
 
Domain Number 4 Region: 334-475
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.85e-44
Family PLC-like (P variant) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009158   Gene: ENSGGOG00000009365   Transcript: ENSGGOT00000009412
Sequence length 1071
Comment pep:known_by_projection chromosome:gorGor3.1:3:180417241:180454239:1 gene:ENSGGOG00000009365 transcript:ENSGGOT00000009412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLH
QLLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGF
AIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPK
HIYNKLDKVIGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSE
QLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQL
PMDCFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVR
TGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKE
EHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEF
DWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTR
DPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQ
AMELLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKA
LTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTD
ILKQEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKR
PLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYG
CLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLF
TRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLT
QDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFD
DIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
Download sequence
Identical sequences ENSGGOP00000009158 ENSGGOP00000009158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]