SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009166 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009166
Domain Number 1 Region: 163-270
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.45e-35
Family ProC C-terminal domain-like 0.00072
Further Details:      
 
Domain Number 2 Region: 1-162
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.75e-27
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009166   Gene: ENSGGOG00000014247   Transcript: ENSGGOT00000009420
Sequence length 320
Comment pep:known_by_projection chromosome:gorGor3.1:1:206073481:206077895:-1 gene:ENSGGOG00000014247 transcript:ENSGGOT00000009420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTCSNKETV
KHSDVLFLAVKPHIIPFILDEIGANVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRC
MTNTPVVVREGATVYATGTHALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAY
AFMALDALADGGVKMGLPRRLAIQLGAQALLGAAKMLLDSEQHPCQLKDNVCSPGGATIH
ALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTL
TPSSPGKLLTRSLTLGGKKD
Download sequence
Identical sequences G3R1T4
XP_004028530.1.27298 ENSGGOP00000009166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]