SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009182 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009182
Domain Number 1 Region: 42-182
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.09e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 727-753,788-941
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-37
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 341-523
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.05e-36
Family Laminin G-like module 0.0071
Further Details:      
 
Domain Number 4 Region: 156-342
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.3e-36
Family Laminin G-like module 0.0044
Further Details:      
 
Domain Number 5 Region: 972-1176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.45e-30
Family Laminin G-like module 0.024
Further Details:      
 
Domain Number 6 Region: 583-640
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000523
Family Fibrinogen C-terminal domain-like 0.0035
Further Details:      
 
Domain Number 7 Region: 554-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000173
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009182   Gene: ENSGGOG00000009394   Transcript: ENSGGOT00000009436
Sequence length 1311
Comment pep:known_by_projection chromosome:gorGor3.1:16:66718329:66969095:1 gene:ENSGGOG00000009394 transcript:ENSGGOT00000009436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFYLFVVLSIDSMKASALTNPNVALFLLADDCDDPLVSALPQASFSSSSELSSSHGPG
FARLNRRDGAGGWSPLVSNKYQWLQIDLGERMEVTAVATQGGYGSSNWVTSYLLMFSDSG
WNWKQYRQEDSIWGFSGNANADSVVYYRLQPSIKARFLRFIPLEWNPKGRIGMRIEVFGC
AYRSEVVDLDGKSSLLYRFDQKSLSPIKDIISLKFKTMQSDGILLHREGPNGDHITLQLR
RGRLFLLINSGEAKLPSTSTLVNLTLGSLLDDQHWHSVLIQHLGKQVNFTVDEHRHHFHA
QGEFNLMNLDYEISFGGIPAPGKSVSFPHRNFHGCLENLYYNGVDIIDLAKQQKPQIIAM
GNVSFSCSQPQSMPVTFLSSRSYLALPDFSGEEEVSATFQFRTWNKAGLLLFSELQLISG
GILLFLSDGKLKSNLYQPGKLPSDITAGVGLNDGQWHSVSLSAKKNHLSVAVDGQMASAA
LLLGPEQIYSGGTYYFGGCPDKSFGSKCKSPLGGFQGCMRLISISGKVVDLISVQQGSLG
NFSDLQIDSCGISDRCLPNYCEHGGECSQSWSTFHCNCTNTGYRGATCHNSIYEQSCEAY
KHRGNTSGFYYIDSDGSGPLEPFLLYCNMTETAWTIIQHNSSDLTKVRNTNPENPYAGFF
EYVASMEQLQATINRAEHCEQEFTYYCKKSRLVNKQDGTPLSWWVGRTNETQTYWGGSSP
DLQKCTCGLEGNCIDSQYYCNCDADRNEWTNDTGLLAYKEHLPVTKIVITDTGRLHSEAA
YKLGPLLCRGDRSFWNSASFDTEASYLHFPTFHGELSADVSFFFKTTASSGVFLENLGIT
DFIRIELRSPTVVTFSFDVGNGPFEISVQSPTHFNDNQWHHVRVERNVKEASLQVDQLTP
KTQPAPADGHVLLQLNSQLFVGGTATRQRGFLGCIRSLQLNGMTLDLEERAQVTPEVQPG
CRGHCSSYGKLCRNGGKCRERPIGFFCDCTFSAYTGPFCSNEISAYFGSGSSVIYNFQEN
YLLNKNSSSHAASFHGDMKLSREMIKFSFRTTRTPSLLLFVSSFYKEYLSVIIAKNGSLQ
IRYKLNKYQEPDVVNFDFKNMADGQLHHIMINREEGVVFIEIDGNTRRQVHLSSGTEFSA
VKSLVLGRILEHSDVDQETALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHV
TESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSAVIGGLIAVVIFILLCI
TAIAVRIYQQKRLYKRSEAKRSENVDSAEAVLKSELNIQNAVNENQKEYFF
Download sequence
Identical sequences ENSGGOP00000009182 ENSGGOP00000009182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]