SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009212 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000009212
Domain Number - Region: 181-205
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00262
Family CCCH zinc finger 0.0036
Further Details:      
 
Domain Number - Region: 13-42
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0196
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number - Region: 215-239
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0576
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009212   Gene: ENSGGOG00000009430   Transcript: ENSGGOT00000009470
Sequence length 388
Comment pep:known_by_projection chromosome:gorGor3.1:3:152860813:153036507:1 gene:ENSGGOG00000009430 transcript:ENSGGOT00000009470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGR
CSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSV
APSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTD
RLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPP
AHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKR
PALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPVPMVHGATPATVSAATTSATSV
PFAATATANQIPIISAEHLTSHKYVTQM
Download sequence
Identical sequences A0A2I3S578 G3R1X8 Q9NR56
ENSGGOP00000009212 NP_997176.1.87134 NP_997176.1.92137 XP_003826501.1.60992 XP_005247523.1.92137 XP_016861914.1.92137 XP_016861915.1.92137 XP_018879631.1.27298 XP_516823.3.37143 ENSPTRP00000046240 9598.ENSPTRP00000046240 9606.ENSP00000282486 gi|46411166|ref|NP_997176.1| ENSP00000417630 ENSPTRP00000046240 ENSP00000282486 ENSP00000418108 ENSP00000282486 ENSP00000418108 ENSGGOP00000009212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]