SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009226 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009226
Domain Number 1 Region: 158-487
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.03e-61
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000235
Further Details:      
 
Domain Number 2 Region: 489-621
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.11e-31
Family Ricin B-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009226   Gene: ENSGGOG00000009442   Transcript: ENSGGOT00000009484
Sequence length 622
Comment pep:known_by_projection chromosome:gorGor3.1:12:49334672:49367012:-1 gene:ENSGGOG00000009442 transcript:ENSGGOT00000009484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLRRRHMPLRLAMVGCAFVLFLFLLHRDVSSREEATEKPWLKSLVSRKDHVLDLMLEA
MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAF
QKSKWTPLETQEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFQRCPPLATTS
VIIVFHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTEEHLKEKLEQYVKQLQVVRV
VRQEERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTVVVSPDIVT
IDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIKSPTFAGGLFS
ISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKG
TSVIARNQVRLAEVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHNFSWY
LHNVYPEMFVPDLTPTFYGAIKNLGTNQCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTT
QRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSHVPKDEEWELAQDQLIRNSGSGTCLTS
QDKKPAMAPCNPSDPHQLWLFV
Download sequence
Identical sequences A0A2I2YBP5
ENSGGOP00000009226 XP_018894616.1.27298 ENSGGOP00000009226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]