SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009257 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009257
Domain Number 1 Region: 132-192
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000683
Family SH3-domain 0.0022
Further Details:      
 
Domain Number 2 Region: 526-635
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000157
Family Second domain of FERM 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009257
Domain Number - Region: 299-408,486-507
Classification Level Classification E-value
Superfamily ARM repeat 0.00207
Family MIF4G domain-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009257   Gene: ENSGGOG00000009450   Transcript: ENSGGOT00000009516
Sequence length 748
Comment pep:novel chromosome:gorGor3.1:5:7626317:7640596:-1 gene:ENSGGOG00000009450 transcript:ENSGGOT00000009516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDLLGGLEVDLDSLTTTEDSVKKRIVVAARDNWANYFSRFFPVSGESGSDVQLLAVSHR
GLRLLKVTQGPGLRPDQLKILCSYSFAEVLGVECRGSSTLELSLKSEQLVLHTARARAIE
ALVELFLNELKKDSGYVIALRSYITDNCSLLSFHRGDLIKLLPVATLEPGWQFGSAGGRS
GLFPADIVQPAAAPDFSFSKEQRSGWHKGQLSNGEPGLARWDRASERPAHPWSQAHSDDS
EATSLSSVAYAFLPDSHSYTMQEFALRYFRRSQALLGQTDGGAAGKDTDSLVQYTKAPIQ
ESLLSLSDDVSKLAVASFLALMQFMGDQSKPRGKDEMDLLYELLKLCQQEKLRDEIYCQV
IKQVTGHPRPEHCTRGWSFLSLLTGFFPPSTGLMPYLTKFLQDSGPSQELARSSQEHLQR
TVKYGGRRRMPPPGEMKAFLKGQAIRLLLIHLPGGVDYRTNIQTFTVAAEVQEELCRQMG
ITEPQEVQEFALFLVKEKSQLVRPLQPAEYLNSVVVDQDVSLHSRRLHWETPLHFDNSTY
ISTHYSQVLWDYLQGKLPVSAKADAQLARLAALQHLSKANRNTPSEQDLLAYVPKQLQQQ
VNTASIKNLMGQELRRLEGHSPQEAQISFIAEAMSQLPLFGYTVYGVLRVSMQALSGPTL
LGLNRQHLILMDPSSQSLYCRIALKSLQRLHLLSPLEEKGPPGLEVNYGSADNPQTIWFE
LPQAQELLYTTVFLIDSSASCTEWPSIN
Download sequence
Identical sequences ENSGGOP00000009257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]