SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009263 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009263
Domain Number 1 Region: 56-81,201-378
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.26e-53
Family G proteins 0.0000000308
Further Details:      
 
Domain Number 2 Region: 85-205
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.66e-34
Family Transducin (alpha subunit), insertion domain 0.00000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009263   Gene: ENSGGOG00000009488   Transcript: ENSGGOT00000009523
Sequence length 381
Comment pep:known_by_projection chromosome:gorGor3.1:7:2720324:2837242:-1 gene:ENSGGOG00000009488 transcript:ENSGGOT00000009523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVVRTLSRCLLPAEAGGARERRAGGGARDAEREARRRSRDIDALLARERRAVRRLVKI
LLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQ
YSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVK
YFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQ
CFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDL
LVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVR
FVFHAVKDTILQENLKDIMLQ
Download sequence
Identical sequences A0A2I3G8L0 A0A2I3LGR7 A0A2K5NYL7 A0A2K5R554 F7HDP8 G3R227 H2PLC9
XP_003274998.1.23891 XP_004045085.1.27298 XP_011742534.1.29376 XP_011885043.1.92194 XP_014988686.1.72884 XP_017389272.1.71028 ENSPPYP00000019410 ENSPPYP00000019410 ENSNLEP00000012941 ENSNLEP00000012941 ENSGGOP00000017939 ENSGGOP00000009263 9600.ENSPPYP00000019411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]