SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009283 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009283
Domain Number 1 Region: 3-81
Classification Level Classification E-value
Superfamily HMG-box 4.84e-27
Family HMG-box 0.00000511
Further Details:      
 
Domain Number 2 Region: 78-147
Classification Level Classification E-value
Superfamily HMG-box 6.28e-26
Family HMG-box 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009283   Gene: ENSGGOG00000026764   Transcript: ENSGGOT00000009543
Sequence length 162
Comment pep:novel chromosome:gorGor3.1:13:12305157:12307355:-1 gene:ENSGGOG00000026764 transcript:ENSGGOT00000009543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKILLHIELKESLMQQKR
Download sequence
Identical sequences ENSGGOP00000009283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]