SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009328 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009328
Domain Number 1 Region: 6-211
Classification Level Classification E-value
Superfamily EPT/RTPC-like 2.62e-53
Family RNA 3'-terminal phosphate cyclase, RPTC 0.0000482
Further Details:      
 
Domain Number 2 Region: 183-272
Classification Level Classification E-value
Superfamily RNA 3'-terminal phosphate cyclase, RPTC, insert domain 0.00000000000000432
Family RNA 3'-terminal phosphate cyclase, RPTC, insert domain 0.023
Further Details:      
 
Domain Number 3 Region: 270-325
Classification Level Classification E-value
Superfamily EPT/RTPC-like 0.0000144
Family RNA 3'-terminal phosphate cyclase, RPTC 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009328   Gene: ENSGGOG00000009546   Transcript: ENSGGOT00000009588
Sequence length 350
Comment pep:known_by_projection chromosome:gorGor3.1:1:102984345:103009396:1 gene:ENSGGOG00000009546 transcript:ENSGGOT00000009588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRVEVDGSIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLSSGGWKSKIKVL
TRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSM
PCVLFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGXX
XXAGVLPFKVAKDMAAAAVRCIRKEIRDLYVNIQPVQEPKDQAFGNGNGIIIIAETSTGC
LFAGSSLGKRGVNADKVGIEAAEMLLANLRHGGTVDEYLQDQLIVFMALANGVSRIKTGP
VTLHTQTAIHFAEQIAKAKFIVKKSEEEEDAAKDTYIIECQGIGMTNPNL
Download sequence
Identical sequences ENSGGOP00000009328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]