SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009329 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009329
Domain Number 1 Region: 105-347,403-487
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.22e-93
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000163
Further Details:      
 
Domain Number 2 Region: 622-684
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000871
Family Ubiquitin-related 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009329   Gene: ENSGGOG00000009540   Transcript: ENSGGOT00000009589
Sequence length 1295
Comment pep:known_by_projection chromosome:gorGor3.1:11:12024849:12103069:1 gene:ENSGGOG00000009540 transcript:ENSGGOT00000009589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IENAAEEPRVLCIIQDTTNSKTVNERITLNLPASTPVRKLFEDVANKVGYINGTFDLVWG
NGINTADMAPLDHTSDKSLLDANFEPGKKNFLHLTDKDGEQPQILLYVGLVNQAMTCYLN
SLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSF
GWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWR
IDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFL
HFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTFIDVEDEKSPQTESCTDSGAE
NEGSCHSDQMSNDFSNDDGVDEGICLETNSGTEKISKSGLEKNSLIYELFSVMVHSGSAA
GGHYYACIKSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTNAYMLI
YRLKDPARNAKFLEVDEYPEHIKNLVQKERELEEQEKRQREIERNTCKIKLFCLHPTKQV
MMENKLEVHKDKTLKEAVEMAYKMMDLEEVIPLDCCRLVKYDEFHDYLERSYEGEEDTPM
GLLLGGVKSTYMFDLLLETRKPDQVFQSYKPGEVMVKVHVVDLKAESVAAPITVRAYLNQ
TVTEFKQLISKAIHLPAETMRIVLERCYNDLRLLSVSSKTLKAEGFFRSNKVFVESSETL
DYQMAFADSHLWKLLDRHANTIRLFVLLPEQSPGSYSKRTAYQKAGGDSGNVDDDCERVK
GPVGSLKSVEAILEESTEKLKSLSLQQQQDGDNGDSSKSTETSDFENIESPLNERDSSAS
VDNRELEQHIQTSDPENFQSEERSDSDVNNDRSTSSVDSDILSSSHSSDTLCNADNAQIP
LANGLDSHSITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEPYA
ADEGSGEGHKWLMVHVDKRITLAAFKQHLEPFVGVLSSHFKVFRVYASNQEFESVRLNET
LSSFSDDNKITIRLGRALKKGEYRVKVYQLLVNEQEPCKFLLDAVFAKGMTVRQSKEELI
PQLREQCGLELSIDRFRLRKKTWKNPGTVFLDYHIYEEDINISSNWEVFLEVLDGVEKMK
SMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFP
CDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKES
SRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
Download sequence
Identical sequences ENSGGOP00000009329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]