SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009341 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009341
Domain Number 1 Region: 129-281
Classification Level Classification E-value
Superfamily C-type lectin-like 1.24e-41
Family C-type lectin domain 0.000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009341   Gene: ENSGGOG00000008200   Transcript: ENSGGOT00000009601
Sequence length 291
Comment pep:known_by_projection chromosome:gorGor3.1:17:7368014:7373665:-1 gene:ENSGGOG00000008200 transcript:ENSGGOT00000009601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIG
SQNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDH
SSLLLHVKQFVSDLRSLSCQMAALQGNGSERACCPVNWVEHERSCYWFSRSGKAWADADN
YCRLEDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQ
PDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLL
Download sequence
Identical sequences G3R297 H2QC22
ENSGGOP00000008016 ENSGGOP00000009341 XP_003810158.1.60992 XP_004058495.1.27298 XP_014197405.1.60992 XP_016786883.1.37143 XP_016786884.1.37143 XP_018868455.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]