SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009366 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009366
Domain Number 1 Region: 80-286
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.97e-24
Family RecA protein-like (ATPase-domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 0.0000654
Family C-terminal domain of RNA polymerase alpha subunit 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009366   Gene: ENSGGOG00000009589   Transcript: ENSGGOT00000009630
Sequence length 294
Comment pep:known_by_projection chromosome:gorGor3.1:14:85729727:85742046:-1 gene:ENSGGOG00000009589 transcript:ENSGGOT00000009630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLDLLDLNPRIIAAIKKAKLKSVKEVLRFSGPDLKRLTNLSSPEVWHLLRTASLHLRGS
SILTALQLHQQKERFPAQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQL
CLAVQFPRQHGGLEADTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRA
RHLQSLGAALRELSSAFQSPVLCINQVTEAMDEQGAAHRPLGFWDERVSPALGITWANQL
LVRLLADRLREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH
Download sequence
Identical sequences G3R2C0
ENSGGOP00000009366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]