SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009370 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009370
Domain Number 1 Region: 3764-3957
Classification Level Classification E-value
Superfamily Fibronectin type III 3.59e-37
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 2 Region: 4420-4626
Classification Level Classification E-value
Superfamily Fibronectin type III 2.92e-35
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 4159-4334
Classification Level Classification E-value
Superfamily Fibronectin type III 3.03e-34
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 1211-1256,1287-1421
Classification Level Classification E-value
Superfamily Fibronectin type III 1.01e-32
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 5 Region: 2422-2565
Classification Level Classification E-value
Superfamily Fibronectin type III 6.7e-32
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 6 Region: 4623-4823
Classification Level Classification E-value
Superfamily Fibronectin type III 3.02e-31
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 7 Region: 1022-1211
Classification Level Classification E-value
Superfamily Fibronectin type III 4.74e-30
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 8 Region: 1598-1786
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.74e-30
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 2220-2424
Classification Level Classification E-value
Superfamily Fibronectin type III 1.94e-28
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 10 Region: 2033-2220
Classification Level Classification E-value
Superfamily Fibronectin type III 7.59e-28
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 11 Region: 2710-2896
Classification Level Classification E-value
Superfamily Fibronectin type III 9.53e-28
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 12 Region: 3480-3610
Classification Level Classification E-value
Superfamily Fibronectin type III 1.55e-26
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 13 Region: 1432-1572
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.13e-26
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 14 Region: 1903-2034
Classification Level Classification E-value
Superfamily Fibronectin type III 7.78e-25
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 15 Region: 3579-3758
Classification Level Classification E-value
Superfamily Fibronectin type III 1.74e-24
Family Fibronectin type III 0.0065
Further Details:      
 
Domain Number 16 Region: 3347-3478
Classification Level Classification E-value
Superfamily Fibronectin type III 4.4e-24
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 17 Region: 1790-1947
Classification Level Classification E-value
Superfamily Fibronectin type III 2.35e-22
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 18 Region: 2579-2712
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-21
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 19 Region: 2911-3040
Classification Level Classification E-value
Superfamily Fibronectin type III 8.14e-21
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 20 Region: 3915-4046
Classification Level Classification E-value
Superfamily Fibronectin type III 3.28e-20
Family Fibronectin type III 0.0046
Further Details:      
 
Domain Number 21 Region: 4040-4155
Classification Level Classification E-value
Superfamily Fibronectin type III 2.73e-17
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 22 Region: 123-291
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.31e-17
Family Pentraxin (pentaxin) 0.081
Further Details:      
 
Domain Number 23 Region: 4325-4431
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000779
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 24 Region: 815-865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 25 Region: 609-659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000137
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 26 Region: 868-910
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 27 Region: 763-812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 28 Region: 715-757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 29 Region: 662-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000558
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 30 Region: 543-595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 31 Region: 970-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 32 Region: 919-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000781
Family Laminin-type module 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009370
Domain Number - Region: 339-414
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0289
Family beta-mannanase CBM 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009370   Gene: ENSGGOG00000009561   Transcript: ENSGGOT00000009634
Sequence length 5088
Comment pep:known_by_projection chromosome:gorGor3.1:1:195786578:196594528:-1 gene:ENSGGOG00000009561 transcript:ENSGGOT00000009634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCPVLSLGSGFLFQVIEMLIFAYFASISLAESRGLFPRLENVGAFKKVSIVPTQAVCGL
PDRSTFCHSSAAAESIQFCTQRFCIQDCPYRSSHPTYTALFSAGLSSCITPDKNDLHPNA
HSNSTSFIFGNHKNCFSSPASPKLMPSFTLAVWLKPEQQGVMCVIERTVDGQIVFKLTIS
EKETMFYYRTVNGLQPPIKVMTLGRILVKKWIHLSVQVHQTKISFFIDGVEKDHTPFDAR
TLSGSITDFASGTVQIGQSLNGLEQFVGRMQDFRLYQVALTNREILEVFSGDLLRLHAQS
HCRCPGSHPRVHPLAQRYCIPNDAGDTADNRVSRLNPEAHPLSFVNDNDVGTSWVSNVFT
NITQLNQGVTISVDLENGQYQVFYIIIQFFSPQPTEIRIQRKKENSLGWEDWQYFARNCG
AFGMKNNGDLEKPDSVNCLQLSNFTPYSRGNVTFSILTPGPNYRPGYNDFYNTPSLQEFV
KATQIRFHFHGQYYTTETAVNLRHRYYAVDEITISGCDRCLPLYNDKPFRQGDQVYAFNC
KPCQCNSHSKSCHYNISVDPFPFEHFRGGGGVCDDCEHNTTGRNCELCKDYFFRQVGIDP
SAIDVCKPCDCEKVGTRNGSILCDQIGGQCNCKRHVSGRQCNQCQNGFYNLQELDPDGCS
PCNCNTSGTVDGDITCHQNSGQCKCKANVIGLRCDHCNFGFKFLRSFNDDGCEPCQCNLH
GSVNKFCNPHSGQCECKKEAKGLQCDTCRENFYGLDVTNCKACDCDTAGSLPGTVCNAKT
GQCICKPNVEGRQCNKCLEGNFYLRQNNSFLCLPCNCDKTGTINGSLLCDKSTGQCPCKL
GVTGLRCNQCEPHRYNLTIDNFQHCQMCECDSLGTLPGTICDPISGQCLCVPNRQGRRCN
QCQPGFYISPGNATGCLPCSCHTTGAVNHICNSLTGQCVCQDASIAGQRCDQCRDHYFGF
NPQTGRCQPCNCHLSGALNETCHLVTGQCFCKQFVTGSKCDACVPSASHLDVNNLLGCSK
TPFQQPPPRGQVQSSSAINLSWSPPDSPNAHWLTYSLLRDGFEIYTTEDQYPYSIQYFLD
TDLLPYTKYSYYIETANVHGSTRSVAVTYKTKPGVPEGNLTLSYIIPIGSDSVTLTWTTL
SNQSGPIEKYILSCAPLAGGQPCVSYEGHETSATIWNLVPFAKYDFSVQACTSGGCLHSL
PITVTTAQAPPQRLSPPKMQKISSTELHVEWSPPVELNGIIIRYELYMRRLRSTKETTSE
ESRVFQSSGWLSPHSFVESANENALKPPQTMATITGLEPYTKYEFRVLAVNMAGSVSSAW
VSERTGESAPVFMIPPSVFPLSSYSLNISWEKPADNVTRGKVVGYDINMVSEQSPQQSIP
TAFSQLLHTAKSQELSYTVEGLKPYRIYEFTITLCNSVGCVTSASGAGQTLAAGIKASFR
TKVPEGLIVFAASPGNQEEYFALQLKKGRLYFLFDPQGSPVEVTTTNDHGKQYSDGKWHE
IIAIRHQAFGQITLDGIYTGSSAILNGSTVIGDNTGVFLGGLPRSYTILRKDPEIIQKGF
VGCLKDVHFMKNYNPSAIWEPLDWQSSEEQINVYNSWEGCPASLNEGAQFLGAGFLELHP
YMFHGGMNFEISFKFRTDQLNGLLLFVYNKDGPDFLAMELKSGILTFRLNTSLAFTQVDL
LLGLSYCNGKWNKVIIKKEGSFISASVNGLMKHASESGDQPLVVNSPVYVGGIPQELLNS
YKHLCLEQGFGGCMKDVKFTRGAVVNLASVSSGAVRVNLDGCLSTDSAVNCRGNDSILVY
QGKEQSVYEGGLQPFTEYLYRVIASHEGGSVYSDWSRGRTTGAAPQSVPTPSRVRSLNGY
SIEVTWDEPVVRGVIEKYILKAYSEDSTRPPHMPSASAEFVNTSTLTGILTGLLPFKNYA
VTLTACTLAGCTESSHALNISTPQEAPQEVQPPVAKSLPSSLLLSWNPPKKANGIITQYR
LYMDGRLIYSGNEENYTVTDLAVFTPHQFLLSACTHVGCTNSSWVLLYTAQLPPEHVDSP
VLTVLDSRTIYIQWKQPRKISGILERYVLYISNHTHDFTIWSVIYNSTELFQDHMLQYVL
PGNKYLIKLGACTGGGCTVSEASEALTDEDIPEGVPAPKAHSYSPDSFNVSWTEPEYPNG
VITSYGLYLDGILIHNSSELSYRAYGFAPWSLHSFRVQACTAKGCALGPLVENRTLEAPP
EGTVNVFVKTQGSRKAHVRWEAPFRPNGLLTYSVLFTGIFYVDPVGNNYTLLNVTKVMYS
GEETNLWVLIDGLVPFTNYTIQVNISNSQGSLITDPITIAMPPGAPDGVLPPRLSSATPT
SLQVVWSTPARNNAPGSPRYQLQMRSGDSTHGFLELFSNPSASLSYEVSDLQPYTEYMFR
LVASNGFGSAHSSWIPFMTAEDKPGPVVPPILLDVKSRMMLVTWQHPRKSNGVITHYNIY
LHGRLYLRTPGNVTNCTVMHLHPYTAYKFQVEACTSKGCSLSPESQTVWTLPGAPEGIPN
PELFSDTPTSVIISWQPPTHPNGLVENFTIERRVKGKEEVTTLVTLPRSHSMRFIDKTSA
LSPWTKYEYRVLMSTLHGGTNSSAWVEVTTRPSRPAGVQPPVVTVLEPDAVQVTWKPPLI
QNGDILSYEIRMPDPHITITNVTSAVLSQKVTHLIPFTNYSVTIVACSGGNGYLGGCTES
LPTYVTTHPTVPQNVGPLSVIPLSESYVVISWQPPSKPNGPNLRYELLRRKIQQPLASNP
PEDLNRWHNIYSGTQWFYEDKGLSRFTTYEYMLFVHNSVGFTLSREVTVTTLAGLPERGA
NLTASVLNHTAIDVRWAKPTVQDLQGEVEYYTLFWSSATSNDSLKILPDVNSHVIGHLKP
NTEYWIFISVFNGVHSINSAGLHATTCDGEPQGMLPPEVVIINSTAVRVIWTSPSNPNGV
VTEYSIYVNNKLYKTGMNVPGSFILRDLSPFTIYDIQVEVCTIYACVKSNGTQITTVEDT
PSDIPTPTIRGITSRSLQIDWVSPRKPNGIILGYDLLWKTWYPCTKTQKLVQDQSDELCK
AVRCQKPEYICGHICYSSEAKVCCNGVLYNPKPGHRCCEEKYIPFVLNSTGVCCGGRIQE
AQPNHQCCSGYYARILPGEVCCPDEQHNRVSVGIGDSCCGRMPYSTSGNQICCAGRLHDG
HGQKCCGGQIVSNDLECCGGEEGVVYSRLPGMFCCGQDYVNMSDTICCSASSGESKAHVK
KNDPVPVKCCETELIPKSQKCCNGVGYNPLKYVCSDKISTGMMMKETKECRILCPASMEA
TAHCGRCDFNFTRHICTVIRGSHNSTGKASIEEMCSSAEETIHTGSVNTYSYTDVNLKPY
MTYEYRISAWNSYGRGLSKAVRARTKEDVPQGVSPPTWTKIDNLEDTIVLNWRKPIQSNG
PIIYYILLRNGIERFRGTSLSFSDKEGIQPFQEYSYQLKACTVAGCATSSKVVAATTQGV
PESILPPSITALSAVALHLSWSVPEKPNGVIKEYQIRQVGKGLIHTDTTDRRQHTVTGLQ
PYTNYSFTLTACTSAGCTSSEPFLGQTLQAAPEGVWVTPRHIIINSTTVELYWSLPEKPN
GLISQYQLSRNGNLLFLGGSEEQNFTDKNLEPNSRYTYKLEVKTGGGSSTSDDYIVQTPM
STPEEIYPPYNITVIGPYSVFVAWIPPGILIPEIPVEYNVLLNDGSVTPLAFSVGHHQST
LLENLTPFTQYEIRIQACQNGSCGVSSRMFVKTPEAAPMDLNSPVLKALGSACIEIKWMP
PEKPNGIIINYFIYRRPAGIEEESVLFVWSEGALEFMDEGDTLRPFTLYEYRVRACNSKG
SVESLWSLTQTLEAPPQDFPAPWAQATSAHSVLLNWTKPESPNGIISHYRVVYQERPDDP
TFNSPTVHAFTVKGTSHQAHLYGLEPFTTYRIGVVAANHAGEILSPWTLIQTLESSPSGL
RNFIVEQKENGRALLLQWSEPMRTNGVIKTYNIFSDGFLEYSGLNRQFLFRRLDPFTLYT
LTLEACTTAGCAHSAPQPLWTDEAPPDSQLAPTVHSVKSTSVELSWSEPVNPNGKIIRYE
VIRRCFEGKAWGNQTIQADEKIVFTEYNTERNTFIYNDTGLQPWTQCEYKIYTWNSAGHT
CSSWNVVRTLQAPPEGLSPPVISYVSRNPQKLLISWIPPEQSNGIIQSYRLQRNEMLYPF
SFDPVTFNYTDEELLPFSTYSYALQACTSGGCSTSKPTSITTLEAAPSEVSPPDLWAISA
TQMNVCWSPPTVQNGKITKYLVRYDNKESLAGQGLCLLVSHLQPYTQYNFSVVACTNGGC
TASVSKSAWTMEALPKNMDSPTLQVTGSESIEITWKPPRNPNGQIRSYELRRDGTIVYTG
LETRYHDFTLTPGVEYGYTVTASNSQGGILSPLVKDRTSPSAPSGMEPPKLQAGGPQEIL
VNWDPPVRTNGDIINYTLFIRELFERETKIIHINTTHNSFGTQSYIVNQLKPFHRYEIRI
QACTTLGCASSEWTFIQTPEIAPLMQPPPHLEVQMAPGGFQPTVSLLWTGPLQPNGKVLY
YELYRRQIATQPGKSNPVLIYNGSSTSFIDSELLPFTEYEYQVWAVNSAGKAPSSWTWCR
TGPAPPEGLRAPTFHAISSTQAVVNISAPGKPNGIVSLYRLFSSSAHGAETVLSEGMATQ
QTLHGLHAFTNYSIGVEACTCFNCCSKGPTAELRTHPAPPSGLSSPQIKTLASRTASFRW
SPPMFPNGVIHSYELQLHVVCPPDSALSCTPSQIETKYTGLGQKASLGGLQPYTTYKLRV
VAHNEVGSTASEWISFTTQKELPQYRAPFSVDSNLSVVCVNWSDTFLLNGQLKEYVLTDG
GRRMYSGFDTTLYIPRTADKTFFFQVICTTDQGSVKTPLIQYDTSTGLGLVLTTSGEKKG
SRSKSTEFYSELWFIVLMAMLGLILLAIFLSLILQRKIHKEPYIRERPPLVPLQKRMSPL
NVYPQGENHMFDSVADISDVSSNVTLKSYTMHFEGLADTKIPRSGTPVSIRSNRSACVLR
IPSQSQTSLTYSQGSLHRSVSQLMDIQDKKVLMDNSLWEAIMGHNSGL
Download sequence
Identical sequences ENSGGOP00000009370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]