SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009375 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009375
Domain Number 1 Region: 18-167
Classification Level Classification E-value
Superfamily EF-hand 4.94e-39
Family Calmodulin-like 0.0000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009375   Gene: ENSGGOG00000009598   Transcript: ENSGGOT00000009639
Sequence length 169
Comment pep:known_by_projection chromosome:gorGor3.1:5:73223094:73238778:-1 gene:ENSGGOG00000009598 transcript:ENSGGOT00000009639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKKVAMRALGF
DVKKADVLKILKDYDREATGKITFEDFNETVVTDWILERDPHEEILKAFKLFDDDDSGKI
SLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
Download sequence
Identical sequences ENSGGOP00000009375 ENSGGOP00000009375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]