SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009438 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009438
Domain Number 1 Region: 147-376
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-59
Family Nuclear receptor ligand-binding domain 0.000000000858
Further Details:      
 
Domain Number 2 Region: 52-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-27
Family Nuclear receptor 0.00000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009438   Gene: ENSGGOG00000009661   Transcript: ENSGGOT00000009702
Sequence length 490
Comment pep:known_by_projection chromosome:gorGor3.1:5:44054733:44086059:-1 gene:ENSGGOG00000009661 transcript:ENSGGOT00000009702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQL
GEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEADSPSSSEEEPEVC
EDLAGNAASP
Download sequence
Identical sequences K7AAN9 P10827
ENSP00000264637 gi|20127452|ref|NP_003241.2| gi|300116309|ref|NP_001177848.1| ENSP00000264637 ENSP00000377679 ENSGGOP00000009438 NP_001177848.1.87134 NP_001177848.1.92137 NP_003241.2.87134 NP_003241.2.92137 9606.ENSP00000264637 ENSP00000264637 ENSP00000377679 ENSGGOP00000009438 HR4734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]