SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009465 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009465
Domain Number 1 Region: 74-232
Classification Level Classification E-value
Superfamily E set domains 3.08e-54
Family RhoGDI-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009465   Gene: ENSGGOG00000009690   Transcript: ENSGGOT00000009730
Sequence length 236
Comment pep:known_by_projection chromosome:gorGor3.1:5:55802779:55808615:1 gene:ENSGGOG00000009690 transcript:ENSGGOT00000009730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVKKGGGGAGTGTEPAPGPSGPSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPI
GPVPFSQRGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPN
AGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIP
SSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Download sequence
Identical sequences ENSGGOP00000009465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]