SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009478 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009478
Domain Number 1 Region: 6-175
Classification Level Classification E-value
Superfamily E set domains 1.08e-82
Family Arrestin/Vps26-like 0.0000000217
Further Details:      
 
Domain Number 2 Region: 177-393
Classification Level Classification E-value
Superfamily E set domains 5.13e-74
Family Arrestin/Vps26-like 0.00000000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009478   Gene: ENSGGOG00000009699   Transcript: ENSGGOT00000009743
Sequence length 418
Comment pep:known_by_projection chromosome:gorGor3.1:11:72289735:72377511:-1 gene:ENSGGOG00000009699 transcript:ENSGGOT00000009743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
Download sequence
Identical sequences A0A2J8V169 G3R2M1 H2R1Z2 P49407
9606.ENSP00000377141 ENSGGOP00000009478 NP_004032.2.87134 NP_004032.2.92137 XP_004051870.1.27298 XP_016777105.1.37143 ENSP00000409581 ENSGGOP00000009478 gi|10880136|ref|NP_004032.2| ENSP00000409581 ENSP00000353124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]