SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009522 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009522
Domain Number 1 Region: 223-365
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-26
Family C-type lectin domain 0.00092
Further Details:      
 
Domain Number 2 Region: 42-119
Classification Level Classification E-value
Superfamily PR-1-like 0.000000000113
Family PR-1-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009522   Gene: ENSGGOG00000024401   Transcript: ENSGGOT00000009788
Sequence length 375
Comment pep:novel chromosome:gorGor3.1:16:64746812:64759396:-1 gene:ENSGGOG00000024401 transcript:ENSGGOT00000009788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHPETSPGWGHLLAVLLALLGTTWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRS
WVQPPAADMRRLLVWATSSQLGCGRHLCSAGQAAIEAFVCAYSPGGNWEVNGKTIVPYKK
GAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNHGRLNISTCHCHCPPGYTGRYC
QVRCSLQCVHGRFREEECSCVCDIGYGGAQCATKVHFPFHTCDLRIDGDCFMVSSEADTY
YRARMKCQRKGGVLAQIKSQKVQDILAFYLGRLETTNEVIDSDFETTNFWIGLTYKTAKD
SFRWATGEHQAFTSFGFGQPDNHGLVWLSAAMGFGNCVELQASAAFNWNDQRCKTRNRYI
CQFAQEHISRWGPGS
Download sequence
Identical sequences G3R2R1
ENSGGOP00000009522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]