SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009523 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009523
Domain Number 1 Region: 326-693
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.84e-106
Family beta-glycanases 0.000000582
Further Details:      
 
Domain Number 2 Region: 21-214
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-48
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00037
Further Details:      
 
Domain Number 3 Region: 217-327
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000000000312
Family beta-Galactosidase/glucuronidase domain 0.0061
Further Details:      
 
Domain Number 4 Region: 699-798
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000201
Family beta-Galactosidase/glucuronidase domain 0.016
Further Details:      
 
Domain Number 5 Region: 803-882
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.000000604
Family beta-Galactosidase/glucuronidase domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009523   Gene: ENSGGOG00000009746   Transcript: ENSGGOT00000009789
Sequence length 882
Comment pep:known_by_projection chromosome:gorGor3.1:4:111883775:112012953:-1 gene:ENSGGOG00000009746 transcript:ENSGGOT00000009789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLHLLLLLALCGAGTTAAELSYSLRGNWSICNGNGSLELPGAVPGCVHSALFQQGLIQD
SYYRFNDLNYRWVSLDNWTYSKEFKIPFEISKWQKVNLILEGVDTVSKILFNEVTIGETD
NMFNRYSFDITNVVRDVNSIELRFQSAVLYAAQQSKAHTRYQVPPDCPPLVQKGECHVNF
VRKKLQEQCSFSWDWGPSFPTQGIWKDVRIEAYNICHLNYFTFSPIYDKSAQEWNLEIES
TFDVVSSKPVGGQVIVAIPKLQTQQTYNIELQPGKRIVELFVNISKNITVETWWPHGHGN
QTGYNMTVLFELDGGLNIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGFPIFLKGSNW
IPADSFQDRVTSELLRLLLQSVVDANMNTLRVWGGGIYEQDEFYELCDELGIMVWQDFMF
ACALYPTDQGFLDSVTAEVAYQIKRLKSHPSIIIWSGNNENEEALMMNWYHISFTDRPIY
IKDYVTLYVKNIRELVLAGDKSRPFITSSPTNGAETVAEGWVSQNPNSNYFGDVHFYDYI
SDCWNWKVFPKARFASEYGYQSWPSFSTLEKVSSTEDWSFNSKFSLHRQHHEGGNKQMLY
QAGLHFKLPQSTDPLRTFKDTIYLTQVMQAQCVKTETEFYRRSRSEIVDQQGHTMGALYW
QLNDIWQAPSWASLEYGGKWKMLHYFAQNFFAPLLPVGFENENTFYIYGVSDLHSDYSMT
LTVRVHTWSSLEPVCSRVTERFVMKGGEAVCLYEEPVSELLRRCGNCTRESCVVSFYLSA
DHELLSPTNYHFLSSPKEAVGLCKAQITAIISQQGDVFVFDLETSAVAPFVWLDVGSIPG
RFSDNGFLMTEKTRTILFYPWEPTSKNELERSFHVTSLTDIY
Download sequence
Identical sequences ENSGGOP00000009523 ENSGGOP00000009523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]