SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009579 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009579
Domain Number 1 Region: 231-342
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.88e-22
Family SPRY domain 0.013
Further Details:      
 
Domain Number 2 Region: 375-525
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000473
Family Nucleotide and nucleoside kinases 0.029
Further Details:      
 
Domain Number 3 Region: 2-40
Classification Level Classification E-value
Superfamily SAP domain 0.00000000403
Family SAP domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009579   Gene: ENSGGOG00000009804   Transcript: ENSGGOT00000009845
Sequence length 809
Comment pep:known_by_projection chromosome:gorGor3.1:19:38638311:38682865:1 gene:ENSGGOG00000009804 transcript:ENSGGOT00000009845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELDADDQPGRPGHI
NEEVETEGGSELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQFYDTQVIKQEN
ESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRG
RGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTINEEISVKHLPSTEPDPHVVRIGWS
LDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTK
NGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSE
RIRGTVGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGL
RRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRK
AIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLFIELQREEA
DKLVRQYNEEGRKAGPPPEKRFDNRGGGGFRGRGGGGGFQRYDNRGPPGGNRGGFQNRGG
GSSGGGNYRGGFNRSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQPPPPQPP
PQQPPPPPSYSPARNPPGASTYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGY
SQGYTAPPPPPPPPPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYY
QNQGQWPPYYGNYDYGSYSGNTQGGTSTQ
Download sequence
Identical sequences ENSGGOP00000009579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]