SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009583 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009583
Domain Number 1 Region: 382-630
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.54e-73
Family Eukaryotic proteases 0.0000000239
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009583
Domain Number - Region: 129-155
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00049
Family Pan module (APPLE domain) 0.023
Further Details:      
 
Domain Number - Region: 221-245
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0147
Family Hairpin loop containing domain 0.077
Further Details:      
 
Domain Number - Region: 30-63
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0169
Family Pan module (APPLE domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009583   Gene: ENSGGOG00000009809   Transcript: ENSGGOT00000009849
Sequence length 632
Comment pep:known_by_projection chromosome:gorGor3.1:4:197107490:197128666:1 gene:ENSGGOG00000009809 transcript:ENSGGOT00000009849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFT
FTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDM
KGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITK
LDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCARICTHHPGCLFFT
FFSKEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTD
FLGEELDIVAAKSHEACQKLCTDAVRCQFFTYTPAQASCNEVSNCRGKCYLKLSSNGSPT
KILHGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCG
GSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAES
GYDIALLKLETTVNYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRGSGLIKTERQKS
PKLIIFNETCNYKRFLYRHYIKGPRQHFRQNQPEQDVLKGDSGGPLSCKHNEVWHLVGIT
SWGEGCAQRERPGVYTNVVEYVDWILEKTQAV
Download sequence
Identical sequences ENSGGOP00000009583 ENSGGOP00000009583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]