SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009642 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000009642
Domain Number - Region: 414-474
Classification Level Classification E-value
Superfamily Sialidases 0.0432
Family Sialidases (neuraminidases) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009642   Gene: ENSGGOG00000009858   Transcript: ENSGGOT00000009909
Sequence length 1116
Comment pep:known_by_projection chromosome:gorGor3.1:14:73299735:73474278:-1 gene:ENSGGOG00000009858 transcript:ENSGGOT00000009909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPLIYVSVLLLNIFEFSSGIVYNKDDTEKRFACSNKGFPQENEIIKLYLFLENLKIQC
FFQTENEIASKAMLSVFTSGGLAPSLGIMNSTYNGIFHFNLTLFSDRILWLVDIPRENIT
QSTDIAAVEEWLVRITLHHGLNIYATEGTLLDIIREPILQWTPGDVIPESEISKLYPHVV
DLKVTKCPCANDVALLGFIVDTIVDGVYIGITFGGFWHDYDTTWFNMTQTIYSQLQEEHE
GLSLVDMVLTNHFLVILTSLGLFVSEDLRYPSRYSLSFSRADFCGFERVDYVKGKLWYNE
RCFANREHFEVDYVTVTFERNRTLSESSSCFYSQEPFLEWVPCLPHIFKGIKIFPTVLTF
LVDQERGTGVYLFYNKVRKTAIASVSTLRNNEPNSQSKFPIFRFPSSFSSPVGMVFHPRS
HFLYAYGNQIWLSVDGGNTFQLIANFHDDIIKKTFHSFYTSAITFVSQRGKVYSTKAGMG
RYSAVGSVTERIFTLYYDHLGFLHKLTLGRFEASGPPTAFGNSRNLFGQPPDMGFETALA
PQHTSLDEIIFFAYVPENEPQETIYSKKFSNIHYGKVIHSGKTGRAYIRRVLQHTTPKGF
LSSVIAEMKEPFGLEEVNESSCLSSSLLINKAGNVYKLTLDSQVVQALFEDTDIEKTVVL
PGYSSFLITSILDNKNALAIATMPESAPNNMTFLKSTWFLYNFGQRNGRTWKIYSKPCNY
WFQHDDSPSLNIVKYIDLGNSYVLKAKVIRNAKGFRMLEIPLLTVFVGNPNLLEVTAEVT
FDDTDSYVITISAASKVLHQGSTSLAFIMWSASTECFVTTMVPTLKSSCSYLRSMHHIPS
KFIPFEDWISGVHKDSQGFNLIKTLPINYRPPSNMGIAIPLTDNFYHADPSKPIPRNMFH
MSKKTGKFKQCANVSTREECNCTKDQKFSHAVAFSDCREKVPRFKFPITQYPVSLEIINE
DGRVPLQSPYLVTVTEVNMRHNWKLKHTVPENIKRMKQLVEPILGAAVYNPSGLNLSIKG
SELFHFRVTVISGVTFCNLIEEFQIYVDEAPLPFPGHTLIAVATAVVLGGLIFIAFMFQL
QGIHPWRTFQRWIRRNQEKFSSISLSELIHRSKSEE
Download sequence
Identical sequences G3R325
ENSGGOP00000009642 XP_004055645.2.27298 ENSGGOP00000009642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]