SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009685 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009685
Domain Number 1 Region: 30-269,337-388
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.37e-98
Family Type II chitinase 0.000000000107
Further Details:      
 
Domain Number 2 Region: 269-336
Classification Level Classification E-value
Superfamily Chitinase insertion domain 9.62e-24
Family Chitinase insertion domain 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009685   Gene: ENSGGOG00000009912   Transcript: ENSGGOT00000009955
Sequence length 391
Comment pep:known_by_projection chromosome:gorGor3.1:1:183164327:183172208:-1 gene:ENSGGOG00000009912 transcript:ENSGGOT00000009955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPCSATARMGVKAAQTGFVVLVLLQCCSAYKLVCYYTSWSQYREGDGSCFPDAIDRFLCT
HIIYSFANISNDHIDTWEWNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASN
TQSRRTFVKSVPPFLRTHGFDGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQL
LLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHGAWRGTTGHHSPLFSGHAPLLWE
AYPTQDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGAPSSGPGIPGRFTKEAG
TLAYYEICDFLGGATVHRILGQQVPYATKGNQWVGYDDQESVKNKVQYLKDRQLAGAMVW
ALDLDDFQGSFCGQDLRFPLTNAIKDALAAT
Download sequence
Identical sequences ENSGGOP00000009685 ENSGGOP00000009685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]