SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009690 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000009690
Domain Number - Region: 141-204
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.0068
Family GS domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009690   Gene: ENSGGOG00000009926   Transcript: ENSGGOT00000009965
Sequence length 215
Comment pep:known_by_projection chromosome:gorGor3.1:X:104517204:104555166:1 gene:ENSGGOG00000009926 transcript:ENSGGOT00000009965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMESENMDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIG
AMGPGNIGPPQIEELKVIPETSEENNKDIWNSEEIPEGAEYDDMWDVREIPEYEIIFRQQ
VGTEDIFLGLSKKDSSTGCCSELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLP
ELVECASAKAFYIPETETLEITMTMKRELDIANFF
Download sequence
Identical sequences ENSGGOP00000009690 ENSGGOP00000009690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]