SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009720 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009720
Domain Number 1 Region: 896-1135
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.41e-52
Family Ankyrin repeat 0.0000000601
Further Details:      
 
Domain Number 2 Region: 141-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000256
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 3 Region: 227-363
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000439
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 4 Region: 177-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 5 Region: 104-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000034
Family EGF-type module 0.026
Further Details:      
 
Domain Number 6 Region: 359-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 540-573
Classification Level Classification E-value
Superfamily Notch domain 0.000000068
Family Notch domain 0.0052
Further Details:      
 
Domain Number 8 Region: 580-612
Classification Level Classification E-value
Superfamily Notch domain 0.00000011
Family Notch domain 0.0043
Further Details:      
 
Domain Number 9 Region: 60-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family EGF-type module 0.016
Further Details:      
 
Domain Number 10 Region: 442-479
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000901
Family EGF-type module 0.02
Further Details:      
 
Domain Number 11 Region: 499-531
Classification Level Classification E-value
Superfamily Notch domain 0.00000111
Family Notch domain 0.00017
Further Details:      
 
Domain Number 12 Region: 396-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000387
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009720
Domain Number - Region: 25-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00205
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009720   Gene: ENSGGOG00000009937   Transcript: ENSGGOT00000009997
Sequence length 1574
Comment pep:novel chromosome:gorGor3.1:9:120138228:120173155:-1 gene:ENSGGOG00000009937 transcript:ENSGGOT00000009997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLLAPLLCLALLPALAARGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDP
NPCLSTPCKNAGTCHVVDRRGMADYACSCPLGFSGPLCLTPLDNACLTNPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVN
ECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVT
HECACLPACLDLPNTYKCSCPRGTQGVHCEINVDDCNPPIDPVSRSPKCFNNGTCVDQVG
GYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVIN
GCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRS
PTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILD
YSFGGGAGRDIPPPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKN
CTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGC
NSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRD
AHGQQMIFPYYGREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPM
DVRGSIVYLEIDNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPP
PPAQLHFMYVAAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGE
DSVGLKPLKNASDGALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHHG
FTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRS
DAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLIL
AARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNRE
ETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNLVRS
PQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRKPSSKGLACGSKEAKDLKARRK
KSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSVPLNHLPGMPDTH
LGIGHLNVAAKPEMAALGGGGRLTFETGPPRLSHLPVASGTSTVLGSSSGGALNFTVGGS
TSLNGQCEWLSRLQSGMVPNQYNPLRGNVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQ
MMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNLQPANIQQQQSLQPPPPPPQPHLGV
SSAASGHLGRSFLSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQF
LTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPT
SMQSQIARIPEAFK
Download sequence
Identical sequences ENSGGOP00000009720 ENSGGOP00000009720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]