SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009730 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009730
Domain Number 1 Region: 30-166
Classification Level Classification E-value
Superfamily Cupredoxins 6.02e-48
Family Ephrin ectodomain 0.00000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009730   Gene: ENSGGOG00000009968   Transcript: ENSGGOT00000010008
Sequence length 346
Comment pep:known_by_projection chromosome:gorGor3.1:X:65987054:66000217:1 gene:ENSGGOG00000009968 transcript:ENSGGOT00000010008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKL
DIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPN
YMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSR
PSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVAL
FAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPS
DIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Download sequence
Identical sequences G1QIU1 G3R3A6
XP_003272718.1.23891 XP_004064354.1.27298 ENSGGOP00000009730 ENSGGOP00000009730 ENSNLEP00000000835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]