SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009768 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009768
Domain Number 1 Region: 116-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000057
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 263-322
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000389
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 78-126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000306
Family Complement control module/SCR domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009768   Gene: ENSGGOG00000010009   Transcript: ENSGGOT00000010047
Sequence length 465
Comment pep:known_by_projection chromosome:gorGor3.1:X:97907250:97934711:1 gene:ENSGGOG00000010009 transcript:ENSGGOT00000010047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQLTQRGALSLLFFLTPAVTPTWYAGSGYYPDESYNEVYAEEVPQAPALDYRVPRWCY
TLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQM
RCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDID
PPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIR
YTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQG
TPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQ
ISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVL
IDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE
Download sequence
Identical sequences A3FEK6 G3R3E3
ENSGGOP00000009768 ENSGGOP00000009768 XP_004064541.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]