SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009782 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009782
Domain Number 1 Region: 124-274
Classification Level Classification E-value
Superfamily EF-hand 1.28e-39
Family Calmodulin-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009782   Gene: ENSGGOG00000010025   Transcript: ENSGGOT00000010062
Sequence length 275
Comment pep:known_by_projection chromosome:gorGor3.1:11:64365498:64369216:1 gene:ENSGGOG00000010025 transcript:ENSGGOT00000010062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEQARGQHGPNLATGHQKPPAGVVTPKSDAEEPPLTRKRSKKERGLRGSRKRTGSSGE
QTGPEAPGSSNNPPSTGEGPAGAPPAISGPASSRQSHRHRPDSRHDAAQRTYGPLLNRVF
GKDRELGPEELDELQAAFEEFDTDRDGYISHRELGDCMRTLGYMPTEMELLEVSQHIKMR
MGGRVDFEEFVELIGPKLREETAHMLGVRELRIAFREFDRDRDGRITVAELREAVPALLG
EPLAGPELDEMLREVDLNGDGTVDFDEFVMMLSRH
Download sequence
Identical sequences G3R3F6
ENSGGOP00000009782 ENSGGOP00000009782 XP_004051693.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]