SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009787 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009787
Domain Number 1 Region: 6-34,88-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-19
Family Voltage-gated potassium channels 0.0036
Further Details:      
 
Domain Number 2 Region: 155-257
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-18
Family Voltage-gated potassium channels 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009787   Gene: ENSGGOG00000010031   Transcript: ENSGGOT00000010067
Sequence length 314
Comment pep:known_by_projection chromosome:gorGor3.1:19:35696809:35818096:1 gene:ENSGGOG00000010031 transcript:ENSGGOT00000010067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPAL
DAFVERVLAAGRLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAG
KAFSIAFALLGVPTTMLLLTASAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGV
IVTICFLVPAVIFAHLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVT
VYLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFNEDEDDRVDILGPQPESHQQ
LSASSHTDYASIPR
Download sequence
Identical sequences ENSGGOP00000009787 ENSGGOP00000009787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]