SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009791 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009791
Domain Number 1 Region: 549-818
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-82
Family Protein kinases, catalytic subunit 0.000000473
Further Details:      
 
Domain Number 2 Region: 1-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.19e-59
Family FCH domain 0.00093
Further Details:      
 
Domain Number 3 Region: 451-581
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-31
Family SH2 domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009791   Gene: ENSGGOG00000010028   Transcript: ENSGGOT00000010071
Sequence length 822
Comment pep:known_by_projection chromosome:gorGor3.1:5:91699804:92144379:1 gene:ENSGGOG00000010028 transcript:ENSGGOT00000010071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTVQ
MNYVSNVSKSWLLMIQQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQ
IEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHM
LHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEI
VNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNL
TAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQAL
EELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSK
FESIRHSIAGIIRSPKSALGSSALSDMISISEKPLAEQDWYHGAIPRIEAQELLKKQGDF
LVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITK
KSGVVLLNPIPKDKKWILSHEDVILGELLGKGNFGEVYKGTLKDKTSVAVKTCKEDLPQE
LKIKFLQEAKILKQYDHPNIVKLIGVCTQRQPVYIIMELVSGGDFLTFLRRKKDELKLKQ
LVKFSLDAAAGMLYLESKNCIHRDLAARNCLVGENNVLKISDFGMSRQEDGGVYSSSGLK
QIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRMS
APQHCPEDISKIMMKCWDYKPENRPKFSELQKELTIIKRKLT
Download sequence
Identical sequences G3R3G4 K7CY17 P16591 W0S0X4
HR3461 ENSP00000281092 ENSP00000394297 ENSGGOP00000009791 ENSGGOP00000009791 NP_005237.2.87134 NP_005237.2.92137 XP_011541573.1.92137 XP_016809071.1.37143 XP_016809072.1.37143 XP_016809073.1.37143 XP_016809074.1.37143 XP_016809075.1.37143 XP_016809076.1.37143 XP_016809077.1.37143 XP_016864719.1.92137 XP_016864720.1.92137 XP_018883783.1.27298 gi|119964721|ref|NP_005237.2| ENSP00000281092 9606.ENSP00000281092 ENSP00000281092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]