SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009814 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009814
Domain Number 1 Region: 613-725
Classification Level Classification E-value
Superfamily PDZ domain-like 1.03e-24
Family PDZ domain 0.0041
Further Details:      
 
Domain Number 2 Region: 481-590
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-22
Family PDZ domain 0.0061
Further Details:      
 
Domain Number 3 Region: 259-360
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-20
Family PDZ domain 0.015
Further Details:      
 
Domain Number 4 Region: 369-469
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-19
Family PDZ domain 0.014
Further Details:      
 
Domain Number 5 Region: 22-89
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000561
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009814   Gene: ENSGGOG00000010056   Transcript: ENSGGOT00000010095
Sequence length 728
Comment pep:known_by_projection chromosome:gorGor3.1:4:61664226:61807632:-1 gene:ENSGGOG00000010056 transcript:ENSGGOT00000010095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQPESANDPEPLCAVCGQAHSLEENHFYSYPEEVDDDLICHICLQALLDPLDTPCGHTY
CTLCLTNFLVEKDFCPMDRKPLVLQHCKKSSILVNKLLNKLLVTCPFREHCTQVLQRCDL
EHHFQTSCKGASHYGLTKDRKRRSQDGCPDGCASLTATAPSPEVSAAATISLMTDEPGLD
NPAYVSSVEDGQPAISPVDSGRSNRTRARPFERSTIRSRSFKKINRALSVLRRTKSGSAV
ANHADQGRENSENTTAPEVFPRLYHLIPDGEITSIKINRVDPSESLSIRLVGGSETPLVH
IIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVPHNYAVRLLRQPCQVLWLTVMREQK
FHSRNNGQAPDAYGPRDDSFHVILNKSSPQEQLGIKLVRKVDEPGVFIFNVLDGGVADRH
GQLEENDRVLAINGHDLRYGSPESAAHLIQASERRVHLVVSRRVRQQSPDIFQEAGWNSN
GSWSPRPGERSNTPKPLHPTITCHEKVVNIQKDPGESLGMTVAGGASHREWDLPIYVISV
EPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVALLKRTSSSIVLKALEVKEYEPQED
CSSPAALDSNHNMAPPSDWSPSWVMWLELPRCLYNCKDIILRRNTAGSLGFCIVGGYEEY
NGNKPFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGMIHACLARLLKELKGRITLTI
VSWPGTFL
Download sequence
Identical sequences G3R3I7
ENSGGOP00000009814 ENSGGOP00000009814 XP_004038728.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]